CDS

Accession Number TCMCG043C34185
gbkey CDS
Protein Id XP_022875592.1
Location complement(join(1276266..1276443,1276520..1276589,1276687..1276768))
Gene LOC111394036
GeneID 111394036
Organism Olea europaea var. sylvestris

Protein

Length 109aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA417827
db_source XM_023019824.1
Definition RNA cytidine acetyltransferase 2-like [Olea europaea var. sylvestris]

EGGNOG-MAPPER Annotation

COG_category H
Description RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs. Catalyzes the formation of N(4)- acetylcytidine (ac4C) in 18S rRNA. Required for early nucleolar cleavages of precursor rRNA at sites A0, A1 and A2 during 18S rRNA synthesis. Catalyzes the formation of ac4C in serine and leucine tRNAs. Requires a tRNA-binding adapter protein for full tRNA acetyltransferase activity but not for 18S rRNA acetylation
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko03009        [VIEW IN KEGG]
KEGG_ko ko:K14521        [VIEW IN KEGG]
EC -
KEGG_Pathway ko03008        [VIEW IN KEGG]
map03008        [VIEW IN KEGG]
GOs GO:0000049        [VIEW IN EMBL-EBI]
GO:0000154        [VIEW IN EMBL-EBI]
GO:0002097        [VIEW IN EMBL-EBI]
GO:0002101        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003723        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005730        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006364        [VIEW IN EMBL-EBI]
GO:0006396        [VIEW IN EMBL-EBI]
GO:0006399        [VIEW IN EMBL-EBI]
GO:0006400        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008033        [VIEW IN EMBL-EBI]
GO:0008080        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009451        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010467        [VIEW IN EMBL-EBI]
GO:0016070        [VIEW IN EMBL-EBI]
GO:0016072        [VIEW IN EMBL-EBI]
GO:0016407        [VIEW IN EMBL-EBI]
GO:0016410        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016746        [VIEW IN EMBL-EBI]
GO:0016747        [VIEW IN EMBL-EBI]
GO:0022613        [VIEW IN EMBL-EBI]
GO:0030490        [VIEW IN EMBL-EBI]
GO:0030684        [VIEW IN EMBL-EBI]
GO:0030686        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034470        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034660        [VIEW IN EMBL-EBI]
GO:0042254        [VIEW IN EMBL-EBI]
GO:0042274        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0044085        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0051391        [VIEW IN EMBL-EBI]
GO:0051392        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1904812        [VIEW IN EMBL-EBI]
GO:1990882        [VIEW IN EMBL-EBI]
GO:1990883        [VIEW IN EMBL-EBI]
GO:1990884        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGTTCTGAAACCATTGAATAATGATGATATTGAAACTAGTGGATCAGATCCGATGGGATTTATTCGGCCTTTTTACCAAGGTTTCAGGCATATTTTCATTCGACTACTGTCGACTACCTTCCGACAAATGGAATACAAGCTTGCGATGAGTATTTTGGATCCCAAGCTAAACTTCTCGGATCTGGTGGACCCTACCTTGTCCTCTTCCAATGGTTTTTTAATTTCAGACCCCCATCTTATGATGCGACTGGAAGCATATGTAAACAATCTAGCCAACTACGAGAAGGTAATGTGTCATCAATGTTTAATATACTTTTGCTGTGTATGA
Protein:  
MVLKPLNNDDIETSGSDPMGFIRPFYQGFRHIFIRLLSTTFRQMEYKLAMSILDPKLNFSDLVDPTLSSSNGFLISDPHLMMRLEAYVNNLANYEKVMCHQCLIYFCCV